PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000318013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 268aa    MW: 30375.2 Da    PI: 6.5166
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000318013genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-11242848
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     Ed+ l ++++ +G g W+  +++ g++R++k+c++rw++yl
    MDP0000318013  2 EDKVLTEYIRIHGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 42
                     9**************************************97 PP

2Myb_DNA-binding52.41.2e-164891146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++
    MDP0000318013 48 RGNITHDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 91
                     7999******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0018144IPR001005SANT/Myb domain
PROSITE profilePS5129412.556142IPR017930Myb domain
CDDcd001678.08E-7242No hitNo description
PfamPF002491.2E-9242IPR001005SANT/Myb domain
SuperFamilySSF466893.91E-24289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-19249IPR009057Homeodomain-like
PROSITE profilePS5129425.1014397IPR017930Myb domain
SMARTSM007175.6E-154795IPR001005SANT/Myb domain
PfamPF002491.5E-144891IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-245096IPR009057Homeodomain-like
CDDcd001674.11E-115293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEDKVLTEYI RIHGEGKWRN LPKRAGLKRC GKSCRLRWLN YLRPDIKRGN ITHDEEELII  60
RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TTIGKRIQVE GRSCSDGNRR RPTQEKTKKP  120
TQSSPEPSTN NSCTKVVRTK ASRCTKMVLP HESHKFGDST EQVIDAAPIF EEVVNNPTVE  180
IDDPLSPMLF LDDENSTSEF LLDFKMDENF LSDFLNVDFS VLYNNEGAGK AAAAAATEDT  240
SNKLHGPDLQ SSMAPIVDSE LDCWLADN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2329714108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.148290.0fruit| leaf
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744630.0DQ074463.1 Malus x domestica MYB11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351076.10.0PREDICTED: trichome differentiation protein GL1-like
SwissprotQ9FJA24e-55TT2_ARATH; Transcription factor TT2
TrEMBLQ2LME91e-159Q2LME9_MALDO; MYB11
STRINGVIT_09s0002g01400.t017e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-56MYB family protein